Highlighting: “"Reactivate"”
. 10117/22,10:31AM Gmell - Your info was found on the dark web
1271-ACK PlAWe er 5 °C4 A Z- t- 4613 ( A livOcx4.)ctifle-Aff + znr-efur
calc.es
M Gmail Jacqueline
E*GANSED CRtHE CRot-1(1414/— ME-TWORK -fritcern N)6 or raw .
Your info was found on the dark web
'I message
CP:Feej
Re -T :
To:
>
EV t oci.,;ce,
c -Th tober 2022 at 05:12
T ti3V4Co)er-falr
-LDEMTIT--/ 1-1-1e Fr - 'SARK WES - 3LACR MARKE
View in browser
_,McAfee logo
Identity Protection Services
A
Your info was stolen!
Your date of birth
was found on the dark weli)
You asked us to keep a look out for‘tDlen_personap
c7;;;TiEwlExpand your protection by adding
ir
more information for us to monitor.
Show me
Your personal info was stolen in a data breaa, but
we're right here with you. We'll guide you through
every step of the way to become safer again.
if you believe your personal information was added for monitoring by
accident or without your approval, you can remove the asset by logging
into your account or by contacting McAfee Customer Support for
assistance.
. in in:I.—I-n.701 • A.••• -- Miteagant=011inlarTtilifirthrilatt.PLIA1746n55364161008493RAMOI=MSCi"3A1746055...
1/3
EFTA00269187
Grind - Your info was found on the dark web
10117722,10:37 AM
How did hackers get my info?
pany databases you might
They usually take it by hacking into com
re or sell ail of this info
:lave an online account with. Then they sha
Internet called the dark
to other hackers in remote places in the
web.
What do they use it for?
ess your banking. social
Hackers can use this info to try and acc
y use it to send you phony
media, or shopping accounts. Or, the
you out of your credit card
links to fake websites that try and trick
numbers and other info.
How can we help?
from the dark web, we warn
While no one can get your info back
all the ways to take back
you when we find it there and show you
control from hackers.
We're here for you.
Stay safe,
Q L1cAfee Tear)
America, South America, the
is bein g sent from : McA fee, LLC (United States, Mexico, Central
This message Ireland Limited (Europe, Middle
Affairs North, LLC (Canada); McAfee
Caribbean, Japan); McAfee Consumer
f%3 A174 6055... 213
641 6 100849 38simpl=msg-
-athreada3A17460553
• ...- ahannw-wymnanmvievigetplaseacch=all&pennthid
EFTA00269188
8/25/22, 2:37 PM Goma - Your enquiry to the eSafety Commissioner: Et4Q-2022-0000919 (SECIs0FFICIAL:Sensitivej CRM:0012589
as
Gmail RE
-Coe-WISED A5
O R.C,PAWW...mtt cpapie
Jacqueline
AND cie.tritNtv_ Acrwt -ry
1 message
Online
To: Jacque C 24 August 202 at 09:11
Dear Jacqueline,
Thank you for your information received by the Safety Commis;;er>and taking the time to write to us.
eemkand we recommend that you seek legal advice and contact the police to
rep concerns you have raisedareasedo
(The
ort criminal activity or orgem et }
If you ever feel that you or your family are in immediate danger, please call Triple Zero - 000.
If you wish to discuss this matter with a legal professional, you can contact Legal Services Commission South
Australia for free by calling
Further information about their services Is available from their website here: https://lsc.sa.gov.au
The eSafety Commissioner can only investigate matters that are contained in the Online Safety Act 2021 (Cth). We
can take action to remove harmful content from the intemet, but we are unable to investigate people or reports of
illegal activity.
Further information and resources about the eSafety Commissioner's role is available from our website at:
www.esafety.gov.au
We hope this information is of assistance.
Illegal and Restricted Content Team
eSafety Commissioner
E
W www.esafety.gov.au
eSafetyCommissioner
1saialist, loscroaawed
NOTICE: This email message is for the sole use of the intended recipient(s)
and may contain confidential and privileged information. My unauthorized
review, use, disclosure or distribution is prohibited. If you are not the
intended recipient, please contact the sender by reply email and destroy all
copies of the original message.
41.• d nnw 4 /4
EFTA00269189
N29/2021 Gmail - Report Abuse
,*oc Gmail Jacqueline Pearce <==
Report Abuse
1 message
- REPiZejci\n-v9"TiVe- 29 March 2021 at 14:32
c..*o - n .
S`Or.LIE`l
HI Jacqueline,
We heard you. Please report malicious activity to thsi email.
Thank You.
•1/4_
e-E)AcrtuS 0t.4
car-rce rt LC, Meg ntfil - tc:0 171.
bos er/Aii,s
EFTA00269190
ciortilaart
e: reg. sicfc m - Jacqueline Pearce - Outlook
Service Ticket #621581 - Jacqueline Pearce - Email Hack - 0400404658
Pit Stop Technologies
Thu 9/07/2020 924 AM
To:
Hello Jacqueline,
Service Ticket # 621581. has been completed. We hope that you are satisfied with the service provided.
If you do not believe this ticket has been complete or have concerns, please respond to this email so we
can address your queries.
__—
Thank you,
Pit Stop Technologies Team
VAVW.glastdu
Top
REEP:AIC YOtla IT O, ne .4 CX.
Ticket #: 621581 Status: Complete
Summaryrtacqueline Pearce - Email Hack4f0400404658
Service Record #621581
Summary: Jacqueline Pearce - Email Hack - 0400404658
Company: Jacqueline Pearce
Contact: Jacqueline Pearce
Phone: 0400-404-658
960 1/1
EFTA00269191
Page 1of1
mew) e-G0C-#
*-FecEE3G0K - so site--ss mows ) f•C(
02Ol 1
Subject: New messages from Andrew Leske
Fro„a
C.Q1OeNCE: F Fite f3t)Ct
*, Ta ()S NESS C CON-1-
Date: Thursday, 25 Augu 20114:11 PM
Andrew Les!ce
the Family are going to use their popularity and venue to provide advertising
opportunities for small businesses around the towil(aimiiiRroWta a ly —.Pe of
business, and not like 3 or 4 hairdressers, once we got one thats it). they have 2
large tvs and a projector coming which they will show your advertising on from
10/1030 -1/130 every single saturday night. i am putting together an info sheet with
how many people they get the ages and genders. this works in adelakle, and i
c:ftonestly can not see why it wouldnt work here. already spread the word to
other places and they are keen as mustard, so I thought i would aask you if be
keen. another thing is the original 10 businesses that sign up will be locked into that
price so if prices go up you wont need to worry about
we (they) are looking at $100 a month or $1000 a year which ever you choose. i
think that i have grabbed all the responsibility and workload so you would continually
deal with myself
have a think and let me know ay
Thanks
Leske
• *• View Conversation on ifacebook • Reply to this email to message Andrew !Asia
RE to (M A gkerti<)4
0120 RAIEs et< - pagusH 1\)OLie
I t_ccice..-_rf) ACCESS TO FA es - C:r.reitrit<6 PROF6SS(01%‘Al-
c:c. v /4124C,
Recis.).657-co copy or PAsseorr ti0 tlEtC
(1&"Ct -TO
d RCA-FE rACEBCOt. Ar7r 0 t•C e2O 620 .
RACE: cc < PROF10E- (.4,QtY Or4 CKS-Or
EFTA00269192
ce.SOAL RCaer - SLACK tilARICer Ext.),V- A/30,SE RING - ,oNtirk
7/14/2020 Mail - Jacqueline Pearce - Outlook
[RSVP up ort Re: RE Su port] Re: uspected rofile theft black market sex
ro de the xual targetin.
Tue 26/04/2016 3:21 AM
To: Jacqueline Pearce
## Please type your reply above this lInc -4tC
Your request (#31318Q) has been updated. To add additional comments, reply to this email;
i c-
Nick (RSVP Support)
•
la 26 Apr, 08:21
Dear Jacqueline,
Thank you for your email.
We are more then happy to provide any and all information relating to your profile.
However, we are unable to locate any recent profiles with the exception of
Degreesofvariability.* — ONCitN)C t /N'T (NI& CROHLE
As this profile has been inactive for a period over 6 months all contact history and
content has been permanently deleted from our servers.
I can reactivate this profile for to see if there is any information that may be of use
to yourself. If you wish for this to be actioned could confirm your date or birth I
can reactivate this profile on your behalf.
Kind regards,
Nick
Customer Support Executive
Pty Ltd ABN 86 067 935 737
Where more Australians meet.
Jacqueline Pearce
25 Apr, 18:19
theft -
This is a follow-up to your previous request 01236€ "Suspected profile
Dear Nick,
Thankyou for contacting me as quickly as possible.
targeting
I am in the middle of legalities involving the suspected sexual
which include
orchestrated by a group of prominent people in prominent positions
EFTA00269193
7/14/2020 SEX- ee- A tSSn -X-1 Mal-Jacqueline Pearce -outlook
RefORC INY.A • --- r ttl ASS‘ST DeMIETD ,
Jacqueline Pearce
26 Apr, 12:01
This is a follow-up to your previous request #313180 "RE: [RSVP Support] Re:
Susp..."
Dear Nick,
Thank you very much for the information.
Yes, that is my profile of which was in use upon your site.
Birth date -
Just a query.. Are you able to extract the information from the main hard drive of
your system?
Although this may take some time and be of an inconvenience to your staff it is of
high importance and priority concerning the circumstances.
I fear and suspect that I may not be the only victim of this crime and the
information of which I am asking is of high importanc- d •ersonal contact
with a member of your service which resulted in exual assault. 2
c This member had been in contact with myself in the yea 20T2F.7
Any information of which I have requested and of which you could supply will be
greatly appreciated.
Kind Regards •
Jacqueline Pearce
This email is a service from RSVP Support.
EFTA00269194
• • • WM.0011.../
Mall - Jacqueline Pearce - Outlook
.M- cRa's 000_6 A cc..Q6NTS
Microsoft account unusual sign-in activity
Microsoft account team
jsr Wed 21/10/010:07 AM Ac
To:
Mi
X Unusual sign-in activity*
We detected something unusual about a recent sign-i
n to the Microsoft account
To help keep you safe, we required an extra security
challenge.
Sign-in details:
Country/region: Australia
IP address:
Date: 10/21/2015 10:07 AM (LHST)
If this was you, then you can safely ignore this email.
If you're not sure this was you, a malicious user might have your
password. Please review your recent
activity and we'll help you take corrective action.
To opt out or change where you receive security notifications click
, here.
Thanks,
The Microsoft account team
https://oullookilve.corn/mall/O/M1MIADAwATNOrnYAZC1jM2U5L
TZhNWMOADACLTAwegAuAAADXVQ1yWIcnOla0W4CohQ6G
AEAXoEEIVe2F... 1/1
EFTA00269195
7/13/2020 Mel- Jacqueline Pearce - Outlook
kith SEcO CTy - ACCOUNT- rt —rf ) ics op perrE
Microsoft account security info
Microsoft account team
+; Thu 11/021 0,8:56 PM
To:
At Microsoft account
4t Security info replacement
AE. Someone started a process to replace all of the security info for the Microsoft account
•
If this was-you, you can safely ignore this emaAour security info will be replaced with
when the 30-day waiting period is up.
. Click
If this wasn't you, someone else might be trying to take over
here and we'll help you protect this account
Thanks,
The Microsoft account team
Ili.42U5LTZhNWMIMDACLTAwCgAuAAADXVOlyWIcri0taOW4CohO6GAEAXGEEM2F... 1/1
EFTA00269196
7/13/2020 . Mail - Jacqueline Pearce - Outlook
Ct I POSS woKv or oft=yre- sctue try
* Your password changed
Google <r
Wed 5/121 1 ) 11:10 AM 4
* Go gle
Hi Jacqueline,
The password for your Google Account was recently
changed.
Don't recognize this activity?
Click here for more information on how to recover your account.
The Google Accounts team
Help Center.
This email can't receive replies. For more information, visit the Google Accounts
Google product or
You received this mandatory email service announcement to update you about Important changes to your
account.
t 2018 Google LLC, 1600 Amphitheatre Parxway, Mountain View, CA 94043. USA
oh06GAEAXoF Ei%2F.. . 1/
IFINIIIIIIIII/maill0/A0MkADAwATNIZmYA2C1jM2USLT2hNWMtMOACLTAK:gAueAADXVCOMIcnOia0W4C
EFTA00269197
Q.C)
Mel - Jacqueline Pearce -
7/13/2020
1—‘1:3CACI NY% RavloTe G(A) AcE toicce5
LOH POIEA
Microsoft account unusual sign-in activity
Microsoft ount team <
kr. Wed 10 06 020 0:22 AM
To:
Microsoft account
Unusual sign-in activity*'
sign-in to the Microsoft accoune
We detected something unusual about a recent
Sign-in details
Countrnregion: Australia
IP address:
Date: 6/10/2020 10:22 AM (LHST)
Platform: Mac OS
Browser -
you, we'll
nt activ ity pag e to let us kno w whe ther or not this was you. If this wasn't
Please go to your rece the future.
was you, we'll trust similar activity in
help you secure your account.If this
ive security notifications, click here.
To opt out or change where you rece
Thanks,
The Microsoft account team
515
VCIlyWico0laOW4Cotio6GAEAXoEEI%2F...
IM2U5LTZhNWIMMDACLTAwCgAuAAADX
EFTA00269198
11t 21020 Gmal -.Secunly alert change your Weft password
/419_090
POI Gmail
* Security alert: change your Netflix password *.
1 message
ix 23 September (020~t 16:16
To:
Ne
ME1TL)
Action needed: reset your
password
Dear Jacqueline,
* We've detected a suspicious sign-in to your Netflix*
account. Just to be safe, we've reset your password
and you'll need to set a new one.
Use the button above, or type www.netflix.com into
your browser, click on "Sign in" and then click "Need
help?" Follow the instructions to set a new
password.
If you have any questions, we are here to help. Visit
the Help Centre for more info or contact us.
—The Netflix Team
VIEW ALL TV SHOWS & MOVIES
Questions? Visit the Helo Centre.
Netflix International B.V.
678606... 112
EFTA00269199
c meal-6K HP pescrc p QC2I
gLer cei ? NC, _HO L-4OO0 S OCT+ i - C- NA g t_ SVszceas
Gina - Reporting Fraudulent Activity
3/2912021
ail.c
Jacqueline Pearce 1.c.pearce456@gm
M Gmaii
Reporting Fraudulent Activity
1 message
29 March 2021 at
Ja >
Toe
Dear GoDaddy, Higher Authority,
a case of Malicious Fraudul
the adv ice of you r rep res ent ativ e Cristina, Sydney on reporting
I am contacting you on ONS, customer
business account JC INNOVATI
Activity that has occurred in my
has targeted numerot
ts has bee n occ urri ng over a 10 year period and
The Fraudulent activity targeting
my acc oun accounts and recently
ts, em ail acc oun ts, computer hacking, Centrelink
accounts, Wilily accounts. Pho
ne acc oun which has been report(
ing Ho use Aus tin Macauley Publishers, London
Netbank electronic transfers to my Pub lish n. On Thursday i have reporte
with the Fraud Divison for investigatio d
to the Commonwealth Ban k tod ay and pla ced iness account that has Restricte
urri ng for the sec ond tim e in my Telstra Mobile phone bus l acc oun ts with 2 diff ere nt
Fraudulent Activity occ occurred in my -Jersona
s Fraudulent Activity that has t with Teistra Head
Access because of the previou re, Kad ina and escalated toteguesting contac
servers. This report was made
in the lels tra Sto Nrri r I E..p We)
con tinu ous Fra udulent Activity. )1F -Leee
n and rep orte d as CANEQ,S .
-# office CEO for investigatio CE - Re eeCle- ACIESS ivi'
C....c_ICEP-I CA -ne t‘IT SO OR sual activity or suspicious act
Pot. ativ e of you r com pan y to contact and report any unu the pre viou s hac kin g of m
ent representative of
I was informed by a repres as i had info rme d the
s of this account, malware report on that comput
er.
occurs during the setup proces acc oun t, which resulted in 136,000
tem and em ail
previous computer sys
registered business nar
new com put er system registered in my d
Following this report of the malwa
re i pur cha sed a urity systems, newly create
put er tec hni cian , wh ich included numerous Sec ber . Thi s new ly cre ate d
and professionally setup by a
Com
ss pho ne acc oun t and new phone num as a
my newly created bus ine S and not
accounts and emails and und er the bus ine ss registration JC INNOVATION
er were registe red
accounts and business comput
mpted me to get the
personai user. hac king attempts in 2 days which pro
computer system i rec eive d 96 Security measures installed
—4 On start up of the new hno log ies, Kad ina for the computer set up and
Pitstop Tec
support of the IT Specialist ts i
t and newly created accoun
com put er, new ly cre ate d business phone accoun
the
Following this news set up of ivity in these accounts.
to rec eive sus pici ous sign ins and suspicious act
started
0 connected to the email
my novel 31st October 202 sign ins to social media, blo
cked contact with my
Following the publication of sus pici ous
ess to Soc ial Me dia , ail address to my phone
started to receive blocked acc com ing thro ugh to the synchronisedme ail of this em
ails
publishing_house, fraudulent em
not rec eivi ng on my com puter.
i was with Malicious Activil
as being targeted and hacked
I am reporting the email tion into my account.
am requesting an investiga
and Fraudulent Activity and my account
e rec ent ly rem ove d the 2 step verification on
d my phone number and
hav verification on my
I have once again change det ails , pas swo rd, phone number, 2 step
the stages of changing the my details
to this process and am in t an inve stig atio n into this account before i change
es but wished to req ues
account for security purpos
n occurring for you to reviev
e of the targ ete d ma licious activity that has bee
ented evidenc
it s I have attached docum .
ues t to inv estigate this matter further
part of this req
matter.
assistance regarding this
appreciate your time and
Kind Regards
Jacqueline Pearce
JC INNOVATIONS
CC 50Pf'r...I
- RCI, Ogrie.A.11004
4 2 attachments L
aj 1. Report,pdf
2000K
EFTA00269200
here.
Gmail - Thanks for your report. Well take it from
3/2912021
gmail.c
Jacqueline Pearce •1.c.pearce456@
Gmail
from here.
Thanks for your report. We'll take it
2 messages
29 March 2021 at •
24/7 Support:
er Number:
GoDaddy Customer— Custom
GoDaddy
ur
Thanks for submitting yo
report.
lt review your complaint and
particular outcome, but we
We can't guarantee any
.
contact you only if necessary
itional submissions
you r rep ort usi ng the abuse reporting form, add
If you submitted t. If you've
24 hou rs wo n't rec eiv e another notice of receip
from this address within ow for any future
ail, con sid er usi ng the abuse reporting form bel
submitted via em
complaints.
these resources:
For other issues, check out
complaints
Trademark or copyright
Submit them here.
Domain disputes -Resolution Policy.
ICA NN 's Un ifor m Domain-Name Dispute
Please refer to
Account changes
EFTA00269201
4166- UMBER
/
tARRKETIW. POSLISHC11) P.;01 90,20 - (Weil?
W..cace,c) MeRKETI ItiC
RECeiOM4C; CONTACT tJeu_ STREFT If plioN)E
SERVICE- elvli) U._
Icrr RecEivi C otv
sykttiRoNtscn cot-ten-ER CMfflL
sakvice -
TeR..ciET0QC
Linkedln
Simon Sinek and others share their thoughts o
Here are your network highlights
Linkedln
Simon Smek shared a post: On January_
Here's what s happened since you were last on
Linkedln
Forbes and others share their thoughts on unk.
Here are your network highlights
Linkedln N C c 110
Simon Sinek shared a pool: We all..
Here's what's happened since you were lest on..
C inkedln
their. . -
e Wall Street Journal and others share
ere we your network heohlights
0( )
(61+ Linkedln
your netw.
Holly, add Atlyson Carpenter MBA to
cc
P-
Add connections to discover new opportunitie_
vt's
Linkedln
0.
t WORK i.OR SA .7. Icf.is:7;
dr••:9 V.:In.:9110
Hotly jati, scn WORK, f-rift
EFTA00269202
t-tonbeen(QC VI DEO St, t3M inex3 mr*Ken &C.4 pePaRmiari-
FOR SOcilfte- meo ke EsPoskAe-- Ni O N01 MARKET NOQEL,
Holly Jackson
Rae! %Jab
From: Linkedin < t.-X)
Sent
To:
Tuesday, 24 November 2020 6:43 PM
Holly Jackson
ax- tec Mane s n-t;
Subject Congrats! Your video is ready to watch!
Euxten rteRiteriNct
Holly Jackson
Congrats! Your video is ready to watch!
Reality - A riveting,
thought provoking
journey of one...
Go to Linkedin
Get the LinkedIn app.
Stay updated wherever you are
Download for free
Unsubscribe I Halo
You are receiving Linkedin notification emails.
Learn
This email was intended for Holly Jackson (Book Author at JC INNOVATIONS).
why we included this.
Mr'
(0 2020 Linkedin Ireland Unlimited Company, lAfilton Plaza, Wilton Place, Dublin 2.
Linkedin is a registered business name of Linkedin Ireland Unlimited Company.
Linkedin and the Linkedin logo are registered trademarks of Linkedin.
EFTA00269203
TG cmeic, ADDRESS PROM HorJE "140 PRt
3/2912021
DIID "tr Realue ON) at -In I- -W e're t° see you go
P01 Gmail Jacqueline Pearce
FW: We're sorry to see you go
1 message
b9t Hol acksa 1 29 March 2021 at 15:10 k
To:
c riceicc ("Howe- SY,\IC.Ht:c.t.:itSCiTh y frior r fib
NCT Beta:( c cc friruirik emost ≤ is Tow 5 .
FiCCCO•Yr Cue F- Rteit-MXL-;\-ti
Sent from my Samsung Galaxy sman,ohone.
-- Original messaoe
From: Linkedln
Date: 24/3/216:6 it
To: Holly Jackson
Subject: We're sorry to see you go
LinkedMI
We're sorry to see you go
Your Linkedln account is now closed. Although you no longer
have access to it, it'll take a few weeks for your public profile to
disappear from search engines.
You may still receive invitations from Linkedln members and
groups.
You may reactivate your account within 14 days from today by
signing back in, or if you wish to reactivate within the next 48
hours, you may use this link: Reactivate my account
Thanks,
The Linkedln Team
This email was sent to holly.jackson@jcinnovations.com.au.
Linked®
94085.
'112021 Linkedln Corporation. 1000 West Maude Avenue, Sunnyvale, CA
Linkedin.
Link:feta ei iutne Linkedln Iccio are rigistacad tradeMartis of
EFTA00269204
TC.J C-Tiwto MCLcci\TC - holt./ jac Le-or)C4/1,„:Finn°\;olionS .aftl
\jos/ By
THIS nactiCiT HAS Si.."...c.PtAIDED c),:e. -co -THE Socr'ciocs
Holly Jackson Th)riTER 13Lcci•eal NeRt=e- ritt CF Pc:ex-I:Si-Celt) &CK
From: Twitter .1
• Sent Wednesday, 11 Noyembe 020)0:08 AM 4K - (Nz.Y-CTI pa/A
To: ollya BCCC compaeCet
• Subject new or unusual Twitter login ,V (tac tSHI Net Hot.
a,tirtPCI conrittilc r
V
that seem
you?
If this was you
Just to be safe, to log in to this account you'll need to
verify this is really you by entering the following single-
use code.
jqrvrvk8
If this wasn't you
Complete these steps now to protect your account.
• Change your password. You'll be logged out of all
your active Twitter sessions except the one
you're using at this time.
• Review the apps that have access to your
account and revoke access to any unfamiliar
apps. Learn more.
Help Not my account Email security tips
EFTA00269205
tTTER. C.C.a.)nat rie sper,vr-tir -) SCCP c Act( Cr/ .
EFTA00269206
fteces1
/41E-0 NO
kefty gecArzt);N\ct MARKcrs& Cr Noa gentry
Neve: HA° PREAlI cx)5 coN cr WITH - rt-tIS ccarrncr gefuED ,
Holly Jackson coc_v-6 tit etzte -rif.c; 4c
From: Holly Jackson
•A Sent Sunda 14 Feb 1:51 PM ->k"
To:
Cc: oy ac '.n
Subject: Book publishina marketing
At Attachments: Reality - New Release.mp4 - MARse....efrinki V il>60
Reet...rry .
Dear Miles Kemp,
first time author, contracted with Austin
I am contacting you today to inform you of an Australian publication of a
Macauley Publishers, London.
r Holly Jackson gained her first contractwithin
The novel "Reality" was produced over a 6 year period and the autho
name of the book "Reality".
a 3 month period -of submitting one chapter, the main chapter and
broken into 4 books.
"Reality" is the first edition of a series of books, the completed story
301° October 2020 and is new to the market.
The release of the novel in London and on Ebook was released on the
Australia and began an ambitious struggle of
Holly Jackson (author penname) was born in a country town of South
to paper and began a 6 year journey of
education and success in business development before putting pen
her first novel.
discovering and developing her writing style and completing
n of the second edition and then the third
Within the time of writing the first novel Holly began the constructio
edition, before in 2020 beginning the forth edition of the series. Austin
submitted the completed manuscript to her publisher,
Following completing the second novel in 2020 Holly review by
contract within a 3 week period, following a brilliant
Macauley Publishers, London and gained her second
the publisher.
Production Department of Austin Macauley Publishers,
The second novel is now in the editing stages with the ed
ation date of the second book of the series Is still undat
London and is being developed for publication. The public cause d nume rous
has hit that part of the world hard and
and unsure due to the effects of the Coronavirus which
has also been affected and suffered.
delays and problems, of which the publishing house
fight for survival and success
"Reality" — A thought provoking journey of one woman's
escapism, hope and faith in love and triumph over
An emotional journey of eroticism, danger, entrapment, d in
ws of the lies that surrounded her. Gripped and trappe
adversity, and the dark secret that lay hidden in the shado mb
of her strong will to survive and succeed. Will she succu
the sinister evil, lurking and twisting around every step find the streng th within
l temptation of her misguided path or
to the cruel twisted fate of her adversaries, the sexua
to reach for her destiny and succeed?
reality. Inspired by true events.
Jade, one woman's journey, this is her story, this is her
new
and hopefully attract your interest in promoting this
I am submitting this marketing material for you to review
writing.
Australian talent that has just entered the market of doing a
and intere st if you would be interested in knowing more or
Please contact me with your thoughts
promotional article.
I appreciate your time and consideration.
Kind Regards
Holly Jackson
1
EFTA00269207
r)ir) NC't • t<4_ %( MARKEONC, BCOK .
Nichcatt r, CIP-Lv•ccx.c, tcc-
Jacqueline Pearce
From: Jacqueline Pearce
Sent 9 Janua 021 10:30 AM
To:
Cc: Jacque ine Pearce
RE CONFIDENTIAL - NDA Re ' ments
Subject -
eality New Release.mp4; Marketing.jpg *
Attachments:
Dear Yanxia,
•
I am doing really well, thank you.
I hope you are doing well too?
e. As you are well aware it has
hear from you, and yes it has been a whil
Thank you for your email, it was good to
in our society's.
been troubling times with the virus present way. I wish you well always.
r company or you, or your families in any
I hope the epidemic has not affected you
first novel "Reality'.'
ng on the newly released publication of my
At this present moment I am concentrati
h this poin t and I am right in the mist of it all, so very
buialioniore
exciting work to
take n som e time to reac
It has ess I am hoping for.
ible in order to reach the level of succ
do as it requires as much marketing as poss in that area at the moment. I have
plete so all my efforts nconcentrated
This process could take some time to com you could please share it
the pub lishe d nov el for you to viewind would like to ask if
4.included a mar ketin g vide o of
wou ld app reci ate it very muc h. I have also attached a copy of the publishing
house I
with people in your location, I ng a copy.
for you to view and shar e if any interested parties are interested in purchasi
am contracted with
virus I have currently placed
t beca use of this proc ess I am invo lved and because of the epidemic of the
At this poin
until about the middle of this year.
IC INNOVATIONS developments on hold ly discussed after this point if your
ld be inte rest ed in any disc ussi on concerning the projects we have previous
I wou
still interested.
touch. first novel.
I hope this email finds you well. Lets stay in ect, the marketing of my
ld provide concerning my current proj
I would appreciate any assistance you cou
Thank you, stay well. Take care
Kind Regards
Jacqueline Pearce
Director : JC INNOVATIONS
From: Yanxia Zhao
Sent: Friday, 15 January 20211:36 PM
Jo: Jacqueline Pearce
ments
-Subject: RE: CONFIDENTIAL - NDA Require
Dear Jacqueline,
How are you recently?
sincere wishes to you
e I hea rd from you last time, I would like to express our
It has been a long time sinc able way for us to wo
sibi litie s of star ting our discussion again to find out a suit
and try to explore any pos thii
star t our coo per atio n from something small and isolated if you
can
together. As discussed, I think we this can he considered. Thank you so
much in advani
kind ly let us kno w if
that's more convenient, please
7.
EFTA00269208
TM
AUST N MACAU LEY PUBLISHERS
LONDON • CAMBRIDGE • NEW YORK • SHARJAH
Media and Communications
Getting to know you & your book...
Congratulations! Your book is now published and has been passed to us to start the exciting journey of
marketing your book! We work hard to make sure we maximise all opportunities possible — to do this its helpful
for us to understand your journey so far by completing this questionnaire.
*Please indicate if_you ashfir airy detail( to swain confidential.
Full name • Jacqueline Pearce — Please do not provide my real name to any source
Pen name Holly Jackson — Prefer to be known as to other sources
i)
Date of Birti., 021 /01/1971)
+<:ok Reality
Genre Riveting Drama — Inspired by true events
Citizen of Australia
Home address
Please do not provide my home address to any source.
Home phone number
Mobile phone number
4 Email address
Ne.v%4
SYSTEM 9O U
and media,
We may pass on your contact derails to interested parties, including but not limited to local press
libraries, bookshops, charities and schools.
Are you happy for us to do so?
YES xpl NO ID COR/J0-11/2017
EFTA00269209
et-vct-cres) pock c e tNvCLUEMcNT
Page 1 of I
• 'k tNn pRz,c OE -TriesE 6--119Icy
c,tD Not sCiPpul Nci S n Pcurc c r C.c.,kactx
H ARR1 HCC:K - f\sCir
CA) WEt3c.:, iT6 CP" Balf4C, t-letiagg Cf BOW
?PART
%', Fie. r5 HP
RE: Your letter dated 10/03/2020 I Office of Adam Bandt MP
Hook, Harr. Banc7t71P1)<Harry.Hook@aph.goy.au>
6
To
27/03/20. 1:16 AM
)%nkti. t.)67 egOVIDE
Dear Jacqueline, --- Fls c oi.JTAcTi" beTA
Thank you for contacting Adam Bandt MP with your letter and documents dated 10/03/20. My
name is Harry and I am responding on Adam's behalf.
I am sorry that you are experiencing hardship and feel that your safety is at risk from targeting. I
would advise you to contact the police if you feel there is an imminent threat to your safety or the
safety of others. Further, I commend you foneeking solutions to some of the biggest problems
facing us today, such as housing, infection control and waste management and wish you the best
with those endeavours.
I regret to inform you that as a federal MP, Adam cannot intervene in legal matters, nor
investigate cases such as yours.
Thank you for writing to Adam, and please don't hesitate to contact us again in future with any
other queries or concerns.
Best wishes,
Harry
c Ha t.lice
Office of Adam Bandt MP
Leader of the Australian Greens and Federal Member for Melbourne
GEL, 296 Brunswick Street, Fitzroy VIC 3065
EO
Pronouns:lie/him
Sign up for regular updates
I respectfully acknowledge the Traditional Custodians of the country on which I work. the
Wurundjeri people of the Kuhn nation. I recognise that sovereignty was never ceded and pay my
respects to Elders past present and amercing.
INTIERCEPTE, lM AIN.I
( 601DeNCE A SENATORS ofr- FI CE
TO
566R( Nd ASS (STAN e- c20QC - rePERAc- Mei seEk - MetaciN5
l... .4.1 • Mrvn nein, /A f;nkew / A /MIL A 11A us A Thii7vrtV A 71'1Rif/T ICI T7h
EFTA00269210